PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001478m
Common NameCARUB_v10001478mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 319aa    MW: 35911.2 Da    PI: 9.982
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001478mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.11.4e-31130188260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK+vkgse+prsY++Ct+++C +kkkve+s    +++ei+Y+g+Hnh+k
  Carubv10001478m 130 DDGYNWRKYGQKQVKGSENPRSYFKCTYPNCLTKKKVETSLVKDQITEIVYKGSHNHPK 188
                      8********************************************************85 PP

2WRKY102.32.7e-32249306259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vkg+++prsYY+Ct++gC+v+k+ver+ +d k v++tYeg+Hnh+
  Carubv10001478m 249 EDGYRWRKYGQKIVKGNPNPRSYYKCTFTGCCVRKHVERAFQDHKSVITTYEGKHNHQ 306
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.1E-28121189IPR003657WRKY domain
PROSITE profilePS5081124.294124189IPR003657WRKY domain
SuperFamilySSF1182902.09E-25125189IPR003657WRKY domain
SMARTSM007747.1E-34129188IPR003657WRKY domain
PfamPF031068.6E-24130187IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-35233308IPR003657WRKY domain
SuperFamilySSF1182902.75E-28240308IPR003657WRKY domain
PROSITE profilePS5081135.737243308IPR003657WRKY domain
SMARTSM007748.0E-36248307IPR003657WRKY domain
PfamPF031063.3E-24249306IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070370Biological Processcellular heat acclimation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSSLDRQRAV PKFKSATPSP LPLSPSPYFT LPKGVSPADL LDSPLLFSSS NILPSPTTGS  60
FPTQSLKWKN NGVLIDQNEI KYEDGKEHSN FSFTNNNTTP PLFIPSMVTQ PFPQLDLSKS  120
ESLSRNKTSD DGYNWRKYGQ KQVKGSENPR SYFKCTYPNC LTKKKVETSL VKDQITEIVY  180
KGSHNHPKPQ STQRSSAAST AVAAHQKSSR GEGHDIGEDE ADAKRWKREE NVKEPRVVVQ  240
TTSDIDILED GYRWRKYGQK IVKGNPNPRS YYKCTFTGCC VRKHVERAFQ DHKSVITTYE  300
GKHNHQIPTP RRSHTSGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-34130308877Probable WRKY transcription factor 4
2lex_A1e-34130308877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00494DAPTransfer from AT5G07100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2246990.0AF224699.1 Arabidopsis thaliana WRKY DNA-binding protein 26 (WRKY26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288236.10.0hypothetical protein CARUB_v10001478mg
SwissprotQ9C5T30.0WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBLR0GW420.0R0GW42_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60005450.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152911518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.11e-159WRKY DNA-binding protein 26